PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG041570.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 143aa    MW: 15923.1 Da    PI: 7.3572
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG041570.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.2e-1868120254
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+
  TRIDC4BG041570.5  68 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRAR 120
                       788899**********************************************8 PP

2HD-ZIP_I/II85.57.3e-2868121154
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARt 54 
                       +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRAR 
  TRIDC4BG041570.5  68 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARL 121
                       69***************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    
WEAAPSLEPS LTLSMPEDTT MTSTASGGVS SMSVGGAVKR ERAEEADLGE MVSSTAAGAE  60
EDDDGSTRKK LRLTKEQSAL LEDRFKEHST LNPKQKVALA KQLNLRPRQV EVWFQNRRAR  120
LVTLYYTRVY VYMILPLQLT VSC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16773TRKKLRL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-32HD-ZIP family protein