PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG040690.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 267aa    MW: 29081.8 Da    PI: 10.8895
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG040690.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind303.29.8e-936426791301
         GAGA_bind  91 lasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesa 183
                       +++++p+g +++++++ +++lq+     ++++  +++eeek+  +  +e+++++  k+ +kkrq++++pk +k kk+kk  +++ ++ +++  
  TRIDC4BG040690.4  64 AVHHHPTGFGMMPDARGAHTLQM-----MQPQEPPVPEEEKIAPPL-VEEHSVVGSKPPVKKRQQGRQPKLPKPKKPKK-VATPGEDGAPKAR 149
                       34999******************.....677777777888766555.556777788888888*****************.5566677777777 PP

         GAGA_bind 184 derskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeG 276
                        +rs+ + k +++v+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt+iS+yPLP++tkrrgaRiagrKmSqgafkk+LekLa+eG
  TRIDC4BG040690.4 150 APRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEG 242
                       79******************************************************************************************* PP

         GAGA_bind 277 ydlsnpvDLkdhWAkHGtnkfvtir 301
                       y+l+np+DLk++WAkHGtnkfvtir
  TRIDC4BG040690.4 243 YNLNNPIDLKTFWAKHGTNKFVTIR 267
                       ************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    
MVTANPLVAC PPSRRLFTWI LCAMRPGCTP RSISISTSTS TTTRTNINSS ISISINIPVN  60
PGHAVHHHPT GFGMMPDARG AHTLQMMQPQ EPPVPEEEKI APPLVEEHSV VGSKPPVKKR  120
QQGRQPKLPK PKKPKKVATP GEDGAPKARA PRSRGPLKPV EMVINGIDFD ISRIPTPVCS  180
CTGAPQQCYR WGAGGWQSAC CTTSISTYPL PMNTKRRGAR IAGRKMSQGA FKKVLEKLAG  240
EGYNLNNPID LKTFWAKHGT NKFVTIR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131137PKKPKKV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.12e-63BBR-BPC family protein