PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG040690.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 154aa    MW: 16950.9 Da    PI: 10.7693
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG040690.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind262.52.4e-8038154185301
         GAGA_bind 185 erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGy 277
                       +rs+ + k +++v+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt+iS+yPLP++tkrrgaRiagrKmSqgafkk+LekLa+eGy
  TRIDC4BG040690.3  38 TRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGY 130
                       689999*************************************************************************************** PP

         GAGA_bind 278 dlsnpvDLkdhWAkHGtnkfvtir 301
                       +l+np+DLk++WAkHGtnkfvtir
  TRIDC4BG040690.3 131 NLNNPIDLKTFWAKHGTNKFVTIR 154
                       ***********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    
MVTANPLVAC PPSRRLFTWI LCAMRPGCTP RSISISTTRS RGPLKPVEMV INGIDFDISR  60
IPTPVCSCTG APQQCYRWGA GGWQSACCTT SISTYPLPMN TKRRGARIAG RKMSQGAFKK  120
VLEKLAGEGY NLNNPIDLKT FWAKHGTNKF VTIR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.14e-63BBR-BPC family protein