PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG040690.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 329aa    MW: 36232.4 Da    PI: 10.2522
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG040690.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind359.95.2e-11023291301
         GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssia...erdaki.......rernlalsekkaavaerd..................maflqrd 64 
                       mdddgs + rn+g+ye     k nlglqlm s+a    rd+k+        +++ a +++ +++++rd                  m+f++++
  TRIDC4BG040690.2   2 MDDDGSLSiRNWGFYETM---KGNLGLQLMPSVAgagHRDTKPllpngtfLQHHNAPHHPPHSHHPRDygngepsggmpteppaihMDFVRNE 91 
                       9**************965...************99899*****999999955555699999******************************** PP

         GAGA_bind  65 kalaernkalverdnkllalllvensla........salpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkk 149
                       +++++++++ + r++k+l+ ++   +          +++p+g +++++++ +++lq+     ++++  +++eeek+  +  +e+++++  k+ 
  TRIDC4BG040690.2  92 AWMHHQHQHQHSREQKVLHAVPLGPAGHighpghavHHHPTGFGMMPDARGAHTLQM-----MQPQEPPVPEEEKIAPPL-VEEHSVVGSKPP 178
                       ********************99988877788999999********************.....677777777888766555.556777788888 PP

         GAGA_bind 150 kkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvy 242
                       +kkrq++++pk +k kk+kk  +++ ++ +++   +rs+ + k +++v+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt+iS+y
  TRIDC4BG040690.2 179 VKKRQQGRQPKLPKPKKPKK-VATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTY 270
                       888*****************.556667777777779********************************************************* PP

         GAGA_bind 243 PLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       PLP++tkrrgaRiagrKmSqgafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  TRIDC4BG040690.2 271 PLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 329
                       **********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    
EMDDDGSLSI RNWGFYETMK GNLGLQLMPS VAGAGHRDTK PLLPNGTFLQ HHNAPHHPPH  60
SHHPRDYGNG EPSGGMPTEP PAIHMDFVRN EAWMHHQHQH QHSREQKVLH AVPLGPAGHI  120
GHPGHAVHHH PTGFGMMPDA RGAHTLQMMQ PQEPPVPEEE KIAPPLVEEH SVVGSKPPVK  180
KRQQGRQPKL PKPKKPKKVA TPGEDGAPKA RAPRSRGPLK PVEMVINGID FDISRIPTPV  240
CSCTGAPQQC YRWGAGGWQS ACCTTSISTY PLPMNTKRRG ARIAGRKMSQ GAFKKVLEKL  300
AGEGYNLNNP IDLKTFWAKH GTNKFVTIR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193199PKKPKKV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.12e-63BBR-BPC family protein