PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG040690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 349aa    MW: 38780 Da    PI: 10.3305
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG040690.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind348.61.5e-10613491301
         GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssia...erdaki.......rernlalsekkaavaerd..................maflqrd 64 
                       mdddgs + rn+g+ye     k nlglqlm s+a    rd+k+        +++ a +++ +++++rd                  m+f++++
  TRIDC4BG040690.1   1 MDDDGSLSiRNWGFYETM---KGNLGLQLMPSVAgagHRDTKPllpngtfLQHHNAPHHPPHSHHPRDygngepsggmpteppaihMDFVRNE 90 
                       9**************965...************99899*****999999955555699999******************************** PP

         GAGA_bind  65 kalaernkalverdnkllalllvensla.............................salpvgvqvlsgtksidslqqlsepqledsavelre 128
                       ++++  ++++ ++++   +++++++ +                              +++p+g +++++++ +++lq+     ++++  +++e
  TRIDC4BG040690.1  91 AWMHPSQHQHQHQHQHHHQNQHQQQHQHqhqhsreqkvlhavplgpaghighpghavHHHPTGFGMMPDARGAHTLQM-----MQPQEPPVPE 178
                       ***994444433333333333332222224466889999999999999999999999999999999999999999999.....6666677778 PP

         GAGA_bind 129 eeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrq 221
                       eek+  +  +e+++++  k+ +kkrq++++pk +k kk+kk  +++ ++ +++   +rs+ + k +++v+ng+++D+s++P+PvCsCtGa++q
  TRIDC4BG040690.1 179 EEKIAPPL-VEEHSVVGSKPPVKKRQQGRQPKLPKPKKPKK-VATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQ 269
                       88766555.566777788888888*****************.556667777777779************************************ PP

         GAGA_bind 222 CYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       CY+WG+GGWqSaCCtt+iS+yPLP++tkrrgaRiagrKmSqgafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  TRIDC4BG040690.1 270 CYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 349
                       *******************************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    
MDDDGSLSIR NWGFYETMKG NLGLQLMPSV AGAGHRDTKP LLPNGTFLQH HNAPHHPPHS  60
HHPRDYGNGE PSGGMPTEPP AIHMDFVRNE AWMHPSQHQH QHQHQHHHQN QHQQQHQHQH  120
QHSREQKVLH AVPLGPAGHI GHPGHAVHHH PTGFGMMPDA RGAHTLQMMQ PQEPPVPEEE  180
KIAPPLVEEH SVVGSKPPVK KRQQGRQPKL PKPKKPKKVA TPGEDGAPKA RAPRSRGPLK  240
PVEMVINGID FDISRIPTPV CSCTGAPQQC YRWGAGGWQS ACCTTSISTY PLPMNTKRRG  300
ARIAGRKMSQ GAFKKVLEKL AGEGYNLNNP IDLKTFWAKH GTNKFVTIR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213219PKKPKKV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.15e-63BBR-BPC family protein