PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG013930.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 381aa    MW: 40173.3 Da    PI: 7.9641
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG013930.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.71.2e-32100153458
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       v+Y+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkC+ACgCHRnFHR+e +
  TRIDC4BG013930.3 100 VKYRECLKNHAAAIGGNATDGCGEFMPS-GEEGSLEALKCSACGCHRNFHRKELD 153
                       89*************************9.999********************976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    
SAAPARSILP DRELRMDLSV PRGEFPIPMH AAASPYGGIG GGGVAVADHA MDLHHDHANH  60
NGQSQSQAQD MPSPPVAVSE DSSGKKRAAA IAVGAGGPPV KYRECLKNHA AAIGGNATDG  120
CGEFMPSGEE GSLEALKCSA CGCHRNFHRK ELDDFDGDSC ASHGYGYGHH AVRRLLGPSV  180
PHHHKSSGGL LVTADHYGAY AAARALPPPP PPPLGHHHQI IMPLNMIQTS ESDEMDGSGG  240
GGIMGDGRGG LASGGGGSSS SKKRFRTKFT AEQKGRMLEF AENVGWRLQK LDDAMVQHFC  300
QEIGVKRRVL KVWMHNNKHN LATRQPPTSP TPPQSQSMPL AMSMPMPLGM SMPMQVPPSQ  360
PGPSGHRGPS SPHAHGELKL D
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.13e-57ZF-HD family protein