PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4BG013090.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 741aa    MW: 80669.8 Da    PI: 6.8858
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4BG013090.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.61.6e-16116170256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rkR ++ + q++eLe++F+++++p+++ r  L+kk+ ++  +Vk+WFqNrR  +k
  TRIDC4BG013090.2 116 RKRGRHANRQIQELEAMFQQCPHPDENLRIALSKKVCMDPLRVKFWFQNRRNAKK 170
                       79999**********************************************8777 PP

2START90.73e-293055255205
                       HHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT CS
             START   5 eaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg 88 
                       +a++el+ +++ +ep+W   +   e ++ + ++ +  ++        ++    r++g+  ++ a+lv++++d + +W+et++  ++++ +s +
  TRIDC4BG013090.2 305 AALRELMMLMKQGEPMWQPAAlggEVLDHQLYRATTLPGLLelpppgFTANGTRDTGLIMCTGADLVRIFMDEN-CWSETFP--DIVASVSAD 394
                       78899999999999999999999988888888888888666889888899999*********************.*******..888888888 PP

                       .........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.....-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  89 .........galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe....sssvvRaellpSgiliepksnghskvtwv 167
                                g + lm+a l +lsp v+  d+ fvR+++  ++g+w++vdvS+d +   +     +     +++lpSg+li+++ ng++kv ++
  TRIDC4BG013090.2 395 nighgcicqGGVILMKAGLRVLSPGVSsCDVKFVRQCQMIEQGVWAVVDVSLDANGTSELrawnTGLPGACRVLPSGCLIKDMNNGYCKVAMI 487
                       8889899999999***********9999*************************9999988887544446679********************* PP

                       E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                        ++++++   +  l++l++sg+ + a++w+  lqr ce
  TRIDC4BG013090.2 488 VNAEYDKGFMRPPLHPLLSSGHTFSARRWLTSLQRRCE 525
                       ***********************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    
MVASLPSLLC WKHCLGVKSG VGSICLVVVW WIWSGQRLGE HGALVVSPFG VDHRSTVAMV  60
GEWQPQNGQV HDEIDLSIPV DDKDLIWSNT GTMDDDEDVA TADEGITDAG SASHMRKRGR  120
HANRQIQELE AMFQQCPHPD ENLRIALSKK VCMDPLRVKF WFQNRRNAKK NQNERQQNMV  180
LRTENIMLEE ENRAMKAAIL KKTCPTCKGP MVFFRPLTPE LRRLHMENAR LKAELLHRTA  240
YLHGVSAGTA GSSRILCDLN VDPVMPLPLR QDDLMADTMG HCAPGGCASA AGGPEHAALE  300
RHVLAALREL MMLMKQGEPM WQPAALGGEV LDHQLYRATT LPGLLELPPP GFTANGTRDT  360
GLIMCTGADL VRIFMDENCW SETFPDIVAS VSADNIGHGC ICQGGVILMK AGLRVLSPGV  420
SSCDVKFVRQ CQMIEQGVWA VVDVSLDANG TSELRAWNTG LPGACRVLPS GCLIKDMNNG  480
YCKVAMIVNA EYDKGFMRPP LHPLLSSGHT FSARRWLTSL QRRCEFLAQR LSPAYGISRA  540
GGAITPEGRN NVLELARRMT ESFYVAISAP RGEAWRKVAD SRGSCGVGGE SFQLAMHVVT  600
PLAAPGEQAA GLVLCATTTA WLPEIPPQRV FDYICDVERR GEWDVLAEGA RVQEDASLAT  660
AQFPLTGVSI LRPTGRGRGG SSCNKKLILQ QACGDAPCMV VAYAPIDTAD LKDVMHGGRR  720
ASLSLLPSGF SILPDGVGDI Q
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-110HD-ZIP family protein