PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG059520.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 151aa    MW: 16418.9 Da    PI: 10.4163
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG059520.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.61.6e-114283256
                      HHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox 32 eLAkklgLterqVkvWFqNrRakek 56
                       LA++lgL  rqV vWFqNrRa+ k
  TRIDC4AG059520.2  4 ALANSLGLRPRQVEVWFQNRRARTK 28
                      79*********************98 PP

2HD-ZIP_I/II87.51.7e-281642892
       HD-ZIP_I/II 28 rKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92
                      +K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e++kr++++l+e+n+rLekev+eLr +lk
  TRIDC4AG059520.2  1 QKLALANSLGLRPRQVEVWFQNRRARTKLKQTEVDCEYMKRWCEQLAEQNRRLEKEVAELR-ALK 64
                      799*********************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    
QKLALANSLG LRPRQVEVWF QNRRARTKLK QTEVDCEYMK RWCEQLAEQN RRLEKEVAEL  60
RALKATPPAH NGAAAGPLTT LTMCLSCKRV ASTSSASACT VPSFSANAGI GMPMPSPVAQ  120
PEHRQFFCGF RDTGAAYGGP AGLTKVVKAA R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12331RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-38HD-ZIP family protein