PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG059520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 266aa    MW: 28267.9 Da    PI: 9.3879
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG059520.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-1989143256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  TRIDC4AG059520.1  89 RKKLRLSKDQAAVLEECFKTHHTLTPKQKLALANSLGLRPRQVEVWFQNRRARTK 143
                       788899***********************************************98 PP

2HD-ZIP_I/II123.51e-3989179192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlsk+q+++LEe+F+++++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e++kr++++l+e+n+rLekev+eLr +lk
  TRIDC4AG059520.1  89 RKKLRLSKDQAAVLEECFKTHHTLTPKQKLALANSLGLRPRQVEVWFQNRRARTKLKQTEVDCEYMKRWCEQLAEQNRRLEKEVAELR-ALK 179
                       69*************************************************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    
MAPQSLDLGL SLGLGLVSRP SQPSFWYSGG NVAADQEVGP TPTAAAVEER RCSPGSPASS  60
GSGSGLKRGA ERSAGSGDED QDDDGGNARK KLRLSKDQAA VLEECFKTHH TLTPKQKLAL  120
ANSLGLRPRQ VEVWFQNRRA RTKLKQTEVD CEYMKRWCEQ LAEQNRRLEK EVAELRALKA  180
TPPAHNGAAA GPLTTLTMCL SCKRVASTSS ASACTVPSFS ANAGIGMPMP SPVAQPEHRQ  240
FFCGFRDTGA AYGGPAGLTK VVKAAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138146RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.12e-52HD-ZIP family protein