PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG059510.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 327aa    MW: 35013.1 Da    PI: 10.6727
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG059510.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-19140194256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Lee+F+ +++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC4AG059510.3 140 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRPRQVEVWFQNRRARTK 194
                       678899***********************************************98 PP

2HD-ZIP_I/II123.69.2e-40140230192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlsk+q+++LEe+F+++++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e++kr++++l+e+n+rLekev+eLr +lk
  TRIDC4AG059510.3 140 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYMKRWCEQLAEQNKRLEKEVAELR-ALK 230
                       69*************************************************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    
SRAPPAEETA RLGSARVGPG QGSDRGRQHA RAPWAMASHR VARKGKGSLT SSTTTASSSP  60
ASHWTAALSS VVGPQESYGL HQYAGHNQPR KEEPGMRTST SPESGVSAGT KRGLERTGSG  120
VSRAAGSDED DDGGDGAGGR KKLRLSKDQA AVLEECFKTH STLNPKQKTA LANRLGLRPR  180
QVEVWFQNRR ARTKLKQTEV DCEYMKRWCE QLAEQNKRLE KEVAELRALK AAPAVHAQQA  240
APAATLTMCP SCRRVAATTA GPAATQHQHQ QPQQCHPKPA AQPAGNVLPS HCQFFPSTTT  300
AAAPDRSGRQ QGAWNGAAQP LVTRELF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189197RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-46HD-ZIP family protein