PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG059510.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 321aa    MW: 33925.8 Da    PI: 10.1157
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG059510.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-19134188256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Lee+F+ +++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  TRIDC4AG059510.2 134 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRPRQVEVWFQNRRARTK 188
                       678899***********************************************98 PP

2HD-ZIP_I/II123.78.9e-40134224192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlsk+q+++LEe+F+++++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e++kr++++l+e+n+rLekev+eLr +lk
  TRIDC4AG059510.2 134 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYMKRWCEQLAEQNKRLEKEVAELR-ALK 224
                       69*************************************************************************************9.555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    
PAPGSSQIGS GRAGERSTMH RAAAAGLDLG LGLGLGLASQ GSLTSSTTTA SSSPASHWTA  60
ALSSVVGPQE SYGLHQYAGH NQPRKEEPGM RTSTSPESGV SAGTKRGLER TGSGVSRAAG  120
SDEDDDGGDG AGGRKKLRLS KDQAAVLEEC FKTHSTLNPK QKTALANRLG LRPRQVEVWF  180
QNRRARTKLK QTEVDCEYMK RWCEQLAEQN KRLEKEVAEL RALKAAPAVH AQQAAPAATL  240
TMCPSCRRVA ATTAGPAATQ HQHQQPQQCH PKPAAQPAGN VLPSHCQFFP STTTAAAPDR  300
SGRQQGAWNG AAQPLVTREL F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183191RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-46HD-ZIP family protein