PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG056280.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 311aa    MW: 34030.6 Da    PI: 4.6433
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG056280.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.31.5e-1957108556
                       SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++  eq+++Le+ Fe +++++ e+++++A+ lgL  rqV vWFqNrRa++k
  TRIDC4AG056280.3  57 RRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWK 108
                       467789*********************************************9 PP

2HD-ZIP_I/II128.92.1e-4155146293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl+ eqv++LE+sFe+++kL+perK+++ar+Lgl+prqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++e
  TRIDC4AG056280.3  55 KKRRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWKTKQLERDFNALRARHDALRADCDALRRDKDALAAEIHE 146
                       9**************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    
HLRRAIGIGM GEKLAFAEKE NLLAAYMEHD EPELEEADEE EEEEERAMSC GLGGKKRRLA  60
LEQVRALERS FETDNKLDPE RKARIARDLG LHPRQVAVWF QNRRARWKTK QLERDFNALR  120
ARHDALRADC DALRRDKDAL AAEIHELREK LSTKPETSVK AEAAGNADAA EERLQQATMI  180
GAAVCKDGSS DSDSSAVFND EASPYSGAVF EQQGFMGFGA SFLDSASAAA ATTGGGCSSL  240
PMLEPKWPGA YPYDAGRSGG YGFTEEWLAG SDAIGNDGSA AFFSEEHVSN LNFGWCSSGA  300
EGFDLQSYCK K
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103111RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-30HD-ZIP family protein