PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG056280.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 318aa    MW: 34921.5 Da    PI: 4.6618
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG056280.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-1964115556
                       SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++  eq+++Le+ Fe +++++ e+++++A+ lgL  rqV vWFqNrRa++k
  TRIDC4AG056280.2  64 RRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWK 115
                       467789*********************************************9 PP

2HD-ZIP_I/II128.52.8e-4162153293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl+ eqv++LE+sFe+++kL+perK+++ar+Lgl+prqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++e
  TRIDC4AG056280.2  62 KKRRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWKTKQLERDFNALRARHDALRADCDALRRDKDALAAEVHE 153
                       9**************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    
MKRQIKRPTR SQESPDAGEK LAFAEKENLL AAYMEHDEPE LEEADEEEEE EERAMSCGLG  60
GKKRRLALEQ VRALERSFET DNKLDPERKA RIARDLGLHP RQVAVWFQNR RARWKTKQLE  120
RDFNALRARH DALRADCDAL RRDKDALAAE VHELREKLST KPETSVKAEA AGNADAAEER  180
LQQATMIGAA VCKDGSSDSD SSAVFNDEAS PYSGAVFEQQ GFMGFGASFL DSASAAAATT  240
GGGCSSLPML EPKWPGAYPY DAGRSGGYGF TEEWLAGSDA IGNDGSAAFF SEEHVSNLNF  300
GWCSSGAEGF DLQSYCKK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110118RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-30HD-ZIP family protein