PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG036520.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 686aa    MW: 74667.5 Da    PI: 6.8395
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG036520.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.63.3e-1662116256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rkR ++ + q++eLe++F+ +++p+++ r  L +k+g++  +Vk+WFqNrR  +k
  TRIDC4AG036520.2  62 RKRGRHANRQIRELEAMFQHCPHPDESLRMALGEKVGMDPLRVKFWFQNRRNAKK 116
                       89999**********************************************8777 PP

2START78.91.2e-252534735205
                       HHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S......EEEEE CS
             START   5 eaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla......kaetl 82 
                       +a++el+ +++ +ep+W   +   e ++ + ++ + +++        ++    r++g+v ++ ++lv++++d + +W et++      +    
  TRIDC4AG036520.2 253 AALNELMMLMKQGEPMWQPAAlggEVLDHQLYRATTVPGLLelpppgFTANGTRDTGMVMCTGTDLVRIFMDEN-CWLETFPdivssvS---- 340
                       78999**************9999988999999999988766999999999999*********************.*******6554333.... PP

                       EEECTT.........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.....-TTS.EE-EESSEEEEEEEECTC CS
             START  83 evissg.........galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe....sssv.vRaellpSgiliepksng 160
                                      g + l +a l +lsp v+  ++ f+R+++  ++g+w++vdvS+d     +       ++   +++lpSg+li+++ ng
  TRIDC4AG036520.2 341 ----ASnigrgcicqGGVILLNAGLRVLSPGVSsFNVKFARQCQMIEQGVWAVVDVSLDAHGTSELrawdI-GLpGDCRVLPSGCLIKDMNNG 428
                       ....333334466665566667777777999998*************************999998875531.2224689************** PP

                       EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       ++kv ++ ++++++   ++ l++l++sg+ + a++w+  lqr ce
  TRIDC4AG036520.2 429 YCKVAMIVNAEYDKGFMPAPLHPLLRSGHTFSARRWLTSLQRRCE 473
                       ******************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    
HQVAMVGEWK PQNGQVHDEI DPSIPTDNKD FIRSNTGTMD DDDDVANADE AITGAGSASN  60
TRKRGRHANR QIRELEAMFQ HCPHPDESLR MALGEKVGMD PLRVKFWFQN RRNAKKNQNE  120
RQQNMVLRTE NLMLAEENRA MKAAMLKKTC PTCKGPMVFI KPLAPPELLR LHMENERLKA  180
DLLRRTAYLH GVSAGTAGPS RILCDLNVDP VAPLPPRQDD LMADTVGHCA PGGCASAAGS  240
GPEHAALERH VLAALNELMM LMKQGEPMWQ PAALGGEVLD HQLYRATTVP GLLELPPPGF  300
TANGTRDTGM VMCTGTDLVR IFMDENCWLE TFPDIVSSVS ASNIGRGCIC QGGVILLNAG  360
LRVLSPGVSS FNVKFARQCQ MIEQGVWAVV DVSLDAHGTS ELRAWDIGLP GDCRVLPSGC  420
LIKDMNNGYC KVAMIVNAEY DKGFMPAPLH PLLRSGHTFS ARRWLTSLQR RCEFLAQRLS  480
PAYGISRAGG AITPEGRNNV LELARRMTES FYAAISAPRG EAWRKIADWR GRDESFQLGM  540
HVVTTLAAPG EQAAGPVLCA TTTVWLPEAP PQRVFDYICD VERRGEWDVL LAEGARVQED  600
ASHATAQFPL GGVSILRPAG RGRGRASCNK KLILQQACGD APCMVVAYAP IDAGELKDVM  660
HGGSRASLPL PPSGFAILPD GVGDMQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-106HD-ZIP family protein