PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG036040.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 322aa    MW: 33855.4 Da    PI: 9.6791
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG036040.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.19e-3374127458
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       v+Y+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkC+ACgCHRnFHR+e +
  TRIDC4AG036040.4  74 VKYRECLKNHAAAIGGNATDGCGEFMPS-GEEGSLEALKCSACGCHRNFHRKELD 127
                       89*************************9.999********************976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    
IPMHQHAAAS PYGGIGGGGV AVADHAMELH HDHANHNGQS QAQDMPSPPA AASEDSSGKK  60
RAAAIAGGAG GPPVKYRECL KNHAAAIGGN ATDGCGEFMP SGEEGSLEAL KCSACGCHRN  120
FHRKELDDFD GDSCASHGYG YGYGHHAVRR LLGPAVPHHH KSSGGLLVTA DHYDHHAAQH  180
DPDVRVGRDG RQRRHHGRRP RRASLGRRRR RLLLVQEALP HQVHRRAEGA HAGVRGERGV  240
ASPEAGRRHG AALLPGDRRQ APRPQGLDAQ QQAQPRQQAA PYLAHAAAVT VNAAGDVNAD  300
AAGHVNADAS AAVAARAFRP PR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1198212RRPRRASLGRRRRRL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.18e-29ZF-HD family protein