PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG036040.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 307aa    MW: 32404.4 Da    PI: 7.1713
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG036040.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.28.3e-3385138458
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       v+Y+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkC+ACgCHRnFHR+e +
  TRIDC4AG036040.3  85 VKYRECLKNHAAAIGGNATDGCGEFMPS-GEEGSLEALKCSACGCHRNFHRKELD 138
                       89*************************9.999********************976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    
MDLSVPRGEF PIPMHQHAAA SPYGGIGGGG VAVADHAMEL HHDHANHNGQ SQAQDMPSPP  60
AAASEDSSGK KRAAAIAGGA GGPPVKYREC LKNHAAAIGG NATDGCGEFM PSGEEGSLEA  120
LKCSACGCHR NFHRKELDDF DGDSCASHGY GYGYGHHPLG HHHQIIMPLN MIQTSESDEM  180
DGSGGIMGDG RGGLASGGGG GGSSSSKKRF RTKFTAEQKG RMLEFAENVG WRLQKLDDAM  240
VQHFCQEIGV KRRVLKVWMH NNKHNLASRP PPTSPTPPQS QSMPLAMSMP MPLGMSMPMQ  300
VPPSQPG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.11e-57ZF-HD family protein