PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG036040.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 383aa    MW: 40113.1 Da    PI: 7.9562
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG036040.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.71.2e-32100153458
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       v+Y+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkC+ACgCHRnFHR+e +
  TRIDC4AG036040.2 100 VKYRECLKNHAAAIGGNATDGCGEFMPS-GEEGSLEALKCSACGCHRNFHRKELD 153
                       89*************************9.999********************976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    
ASASARGILP DREGRMDLSV PRGEFPIPMH QHAAASPYGG IGGGGVAVAD HAMELHHDHA  60
NHNGQSQAQD MPSPPAAASE DSSGKKRAAA IAGGAGGPPV KYRECLKNHA AAIGGNATDG  120
CGEFMPSGEE GSLEALKCSA CGCHRNFHRK ELDDFDGDSC ASHGYGYGYG HHAVRRLLGP  180
AVPHHHKSSG GLLVTADHYG AYAAARALPP PPPPPLGHHH QIIMPLNMIQ TSESDEMDGS  240
GGIMGDGRGG LASGGGGGGS SSSKKRFRTK FTAEQKGRML EFAENVGWRL QKLDDAMVQH  300
FCQEIGVKRR VLKVWMHNNK HNLASRPPPT SPTPPQSQSM PLAMSMPMPL GMSMPMQVPP  360
SQPGPSGHRG PSSPGAQGEL KLD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.15e-56ZF-HD family protein