PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG009990.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 328aa    MW: 36161.3 Da    PI: 10.2522
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG009990.6genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind361.22.1e-11023281301
         GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssia..erdaki.......rernlalsekkaavaerd..................maflqrdk 65 
                       mdddgs + rn+g+ye     k nlglqlm s+a   rd+k+        +++ a +++ +++++rd                  m+f+++++
  TRIDC4AG009990.6   2 MDDDGSLSiRNWGFYETM---KGNLGLQLMPSVAggHRDTKPllpngtfLQHHNAPHHPPHSHHPRDygngepsggmpteppaihMDFVRNEA 91 
                       9**************965...*************999*****999999955555699999********************************* PP

         GAGA_bind  66 alaernkalverdnkllalllvensla........salpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkk 150
                       ++++++++ + r++k+l+ ++   +          +++p+g +++++++ +++lq+     ++++  +++eeek+  +  +e+++++  k+ +
  TRIDC4AG009990.6  92 WMHHQHQHQHSREQKVLHAVPLGPAGHighpghavHHHPTGFGMMPDARGAHTLQM-----MQPQEPPVPEEEKIAPPL-VEEHSVVGSKPPV 178
                       *******************99988877788999999********************.....677777777888766555.5567777888888 PP

         GAGA_bind 151 kkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyP 243
                       kkrq++++pk +k kk+kk  +++ ++ +++   +rs+ + k +++v+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt+iS+yP
  TRIDC4AG009990.6 179 KKRQQGRQPKLPKPKKPKK-VATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYP 270
                       88*****************.556667777777779********************************************************** PP

         GAGA_bind 244 LPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       LP++tkrrgaRiagrKmSqgafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  TRIDC4AG009990.6 271 LPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 328
                       *********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    
EMDDDGSLSI RNWGFYETMK GNLGLQLMPS VAGGHRDTKP LLPNGTFLQH HNAPHHPPHS  60
HHPRDYGNGE PSGGMPTEPP AIHMDFVRNE AWMHHQHQHQ HSREQKVLHA VPLGPAGHIG  120
HPGHAVHHHP TGFGMMPDAR GAHTLQMMQP QEPPVPEEEK IAPPLVEEHS VVGSKPPVKK  180
RQQGRQPKLP KPKKPKKVAT PGEDGAPKAR APRSRGPLKP VEMVINGIDF DISRIPTPVC  240
SCTGAPQQCY RWGAGGWQSA CCTTSISTYP LPMNTKRRGA RIAGRKMSQG AFKKVLEKLA  300
GEGYNLNNPI DLKTFWAKHG TNKFVTIR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192198PKKPKKV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.12e-63BBR-BPC family protein