PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG009990.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 354aa    MW: 39502.8 Da    PI: 10.4519
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG009990.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind77.64.7e-24312731196
         GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssia..erdaki.......rernlalsekkaavaerd..................maflqrdk 65 
                       mdddgs + rn+g+ye     k nlglqlm s+a   rd+k+        +++ a +++ +++++rd                  m+f+++++
  TRIDC4AG009990.2  31 MDDDGSLSiRNWGFYETM---KGNLGLQLMPSVAggHRDTKPllpngtfLQHHNAPHHPPHSHHPRDygngepsggmpteppaihMDFVRNEA 120
                       9**************965...*************999*****999999955555699999********************************* PP

         GAGA_bind  66 alaernkalverdnkllalllvensla.............................salpvgvqvlsgtksidslqqlsepqledsavelree 129
                       +++  ++++ ++++   +++++++ +                              +++p+g +++++++ +++lq+     ++++  +++ee
  TRIDC4AG009990.2 121 WMHPSQHQHQQQHQHHHQNQHQQQHQHqhqhsreqkvlhavplgpaghighpghavHHHPTGFGMMPDARGAHTLQM-----MQPQEPPVPEE 208
                       **983333333333333232222222223455789999999999999999999999999999999999999999999.....66667777788 PP

         GAGA_bind 130 eklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidl 196
                       ek+  +  +e+++++  k+ +kkrq++++pk +k kk+kk  +++ ++ +++   +rs+ + k +++
  TRIDC4AG009990.2 209 EKIAPPL-VEEHSVVGSKPPVKKRQQGRQPKLPKPKKPKKV-ATPGEDGAPKARAPRSRGPLKPVEM 273
                       8766555.556777788888888*****************5.5666777777767999999999998 PP

2GAGA_bind195.18.1e-60273354220301
         GAGA_bind 220 rqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                        qCY+WG+GGWqSaCCtt+iS+yPLP++tkrrgaRiagrKmSqgafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  TRIDC4AG009990.2 273 MQCYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 354
                       69*******************************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    
LTVQSPKEEH ISRSNLGFLG FRFVCSGPAE MDDDGSLSIR NWGFYETMKG NLGLQLMPSV  60
AGGHRDTKPL LPNGTFLQHH NAPHHPPHSH HPRDYGNGEP SGGMPTEPPA IHMDFVRNEA  120
WMHPSQHQHQ QQHQHHHQNQ HQQQHQHQHQ HSREQKVLHA VPLGPAGHIG HPGHAVHHHP  180
TGFGMMPDAR GAHTLQMMQP QEPPVPEEEK IAPPLVEEHS VVGSKPPVKK RQQGRQPKLP  240
KPKKPKKVAT PGEDGAPKAR APRSRGPLKP VEMQCYRWGA GGWQSACCTT SISTYPLPMN  300
TKRRGARIAG RKMSQGAFKK VLEKLAGEGY NLNNPIDLKT FWAKHGTNKF VTIR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242248PKKPKKV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.13e-45BBR-BPC family protein