PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG009990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BBR-BPC
Protein Properties Length: 348aa    MW: 38699.9 Da    PI: 10.3305
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG009990.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind349.76.4e-10713481301
         GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssia..erdaki.......rernlalsekkaavaerd..................maflqrdk 65 
                       mdddgs + rn+g+ye     k nlglqlm s+a   rd+k+        +++ a +++ +++++rd                  m+f+++++
  TRIDC4AG009990.1   1 MDDDGSLSiRNWGFYETM---KGNLGLQLMPSVAggHRDTKPllpngtfLQHHNAPHHPPHSHHPRDygngepsggmpteppaihMDFVRNEA 90 
                       9**************965...*************999*****999999955555699999********************************* PP

         GAGA_bind  66 alaernkalverdnkllalllvensla.............................salpvgvqvlsgtksidslqqlsepqledsavelree 129
                       +++  ++++ ++++   +++++++ +                              +++p+g +++++++ +++lq+     ++++  +++ee
  TRIDC4AG009990.1  91 WMHPSQHQHQQQHQHHHQNQHQQQHQHqhqhsreqkvlhavplgpaghighpghavHHHPTGFGMMPDARGAHTLQM-----MQPQEPPVPEE 178
                       **983333333333333232222222223455789999999999999999999999999999999999999999999.....66667777788 PP

         GAGA_bind 130 eklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqC 222
                       ek+  +  +e+++++  k+ +kkrq++++pk +k kk+kk  +++ ++ +++   +rs+ + k +++v+ng+++D+s++P+PvCsCtGa++qC
  TRIDC4AG009990.1 179 EKIAPPL-VEEHSVVGSKPPVKKRQQGRQPKLPKPKKPKK-VATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQC 269
                       8766555.556777788888888*****************.556667777777779************************************* PP

         GAGA_bind 223 YkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       Y+WG+GGWqSaCCtt+iS+yPLP++tkrrgaRiagrKmSqgafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  TRIDC4AG009990.1 270 YRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 348
                       ******************************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    
MDDDGSLSIR NWGFYETMKG NLGLQLMPSV AGGHRDTKPL LPNGTFLQHH NAPHHPPHSH  60
HPRDYGNGEP SGGMPTEPPA IHMDFVRNEA WMHPSQHQHQ QQHQHHHQNQ HQQQHQHQHQ  120
HSREQKVLHA VPLGPAGHIG HPGHAVHHHP TGFGMMPDAR GAHTLQMMQP QEPPVPEEEK  180
IAPPLVEEHS VVGSKPPVKK RQQGRQPKLP KPKKPKKVAT PGEDGAPKAR APRSRGPLKP  240
VEMVINGIDF DISRIPTPVC SCTGAPQQCY RWGAGGWQSA CCTTSISTYP LPMNTKRRGA  300
RIAGRKMSQG AFKKVLEKLA GEGYNLNNPI DLKTFWAKHG TNKFVTIR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212218PKKPKKV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.14e-63BBR-BPC family protein