PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG009310.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 221aa    MW: 25442.3 Da    PI: 9.1357
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG009310.7genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.5e-182779254
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54
                      rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+
  TRIDC4AG009310.7 27 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRAR 79
                      788899**********************************************8 PP

2HD-ZIP_I/II85.47.6e-282780154
       HD-ZIP_I/II  1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARt 54
                      +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRAR 
  TRIDC4AG009310.7 27 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARL 80
                      69***************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    
RAEEAELGEM VSSTAVGAEE DDDGSTRKKL RLTKEQSALL EDRFKEHSTL NPKQKVALAK  60
QLNLRPRQVE VWFQNRRARL VTLYSTYYYT HISMHSRLYY GPLLELTCNN SCIIHLFIFS  120
KKKTGNHFVC CTPISIHFVL RPCMHEKSAE PLPKITGHFG PGGELSLISN VGSRVTRACR  180
TKLKQTEVDC EFLKRCCETL TEENRRLQRE LQELRAIKFA P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12632TRKKLRL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-31HD-ZIP family protein