PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG005600.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 231aa    MW: 25530.5 Da    PI: 6.571
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG005600.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.5e-1961114356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++++eq + Le  F+k+r++ + ++ +LA++lgL+++qV vWFqNrRa++k
  TRIDC4AG005600.2  61 KKRRLSDEQAQFLEMNFRKERKLETPRKVQLAAELGLDTKQVAVWFQNRRARYK 114
                       45689************************************************9 PP

2HD-ZIP_I/II1117.9e-3661152293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrls+eq+++LE++F++e+kLe+ rKv+la eLgl+++qvavWFqnrRAR+k+k +E+++++L++a+da++ +n+rLe+e  +L+e+l+e
  TRIDC4AG005600.2  61 KKRRLSDEQAQFLEMNFRKERKLETPRKVQLAAELGLDTKQVAVWFQNRRARYKSKLIEEEFSKLRAAHDAVVVHNCRLEAELLRLKERLAE 152
                       9**************************************************************************************99975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    
MSSEEGERLL FPSFVFPDSF PADDATPVVS GGEQKKAGRQ RRRRRARQAA SGEGGGDDAA  60
KKRRLSDEQA QFLEMNFRKE RKLETPRKVQ LAAELGLDTK QVAVWFQNRR ARYKSKLIEE  120
EFSKLRAAHD AVVVHNCRLE AELLRLKERL AETEEEKNKA MAASAAATGG GGGSSPSSSS  180
FSTVTAMVGG QQFGMEEVET DLTYMSEYAY TNYMMDLAAG GYLGGVYDQF S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14164RRRRRARQAASGEGGGDDAAKKRR
24265RRRRRARQAASGEGGGDDAAKKRR
34366RRRRRARQAASGEGGGDDAAKKRR
46182KKRRLSDEQAQFLEMNFRKERK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-29HD-ZIP family protein