PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG002260.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 330aa    MW: 36075.2 Da    PI: 6.4142
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG002260.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74.2e-18115168356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  TRIDC4AG002260.4 115 KKRRLNVEQVRTLEKNFEVANKLEPERKMQLARALGLQPRQVAIWFQNRRARWK 168
                       4568999**********************************************9 PP

2HD-ZIP_I/II130.66.2e-42114204191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       ekkrrl+ eqv++LE++Fe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy++Lkr++da+k+en++L +++++L++e+
  TRIDC4AG002260.4 114 EKKRRLNVEQVRTLEKNFEVANKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDVLKRQFDAVKAENDALLSHNKKLQSEI 204
                       69**************************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    
MASNGMASSP SAFFPPNFLL HMQQAPPQHD PSQEHHQQHH HHHHXXXXXX XXXXXNPFLP  60
SPQCPSLQDF RGGPAMYGGG GDGGCGGDEV TGGGGGGGAN EEETSDDGSQ LGGEKKRRLN  120
VEQVRTLEKN FEVANKLEPE RKMQLARALG LQPRQVAIWF QNRRARWKTK QLEKDYDVLK  180
RQFDAVKAEN DALLSHNKKL QSEILGLKGC REAASELINL NKETEASCSN RSENSSEINL  240
DISRTPPSDG PMDAPPSHQQ GGGSGGGMIP FYPSVARPSA GVDIDHLLHA SVPKMEHHHG  300
GPDTASFGNL LCGVDEPPPF WPWADHQQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163171RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.15e-79HD-ZIP family protein