PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG002260.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 341aa    MW: 37495 Da    PI: 6.3747
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG002260.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.4e-18126179356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  TRIDC4AG002260.3 126 KKRRLNVEQVRTLEKNFEVANKLEPERKMQLARALGLQPRQVAIWFQNRRARWK 179
                       4568999**********************************************9 PP

2HD-ZIP_I/II130.56.6e-42125215191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       ekkrrl+ eqv++LE++Fe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy++Lkr++da+k+en++L +++++L++e+
  TRIDC4AG002260.3 125 EKKRRLNVEQVRTLEKNFEVANKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDVLKRQFDAVKAENDALLSHNKKLQSEI 215
                       69**************************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    
MASNGMASSP SAFFPPNFLL HMQQAPPQHD PSQEHHQQHH HHHHHEXXXX XXXXXXXXXX  60
XXXXXXXXNP FLPSPQCPSL QDFRGAMYGG GGDGGCGGDE VTGGGGGGGA NEEETSDDGS  120
QLGGEKKRRL NVEQVRTLEK NFEVANKLEP ERKMQLARAL GLQPRQVAIW FQNRRARWKT  180
KQLEKDYDVL KRQFDAVKAE NDALLSHNKK LQSEILGLKG CREAASELIN LNKETEASCS  240
NRSENSSEIN LDISRTPPSD GPMDAPPSHQ QGGGSGGGMI PFYPSVARPS AGVDIDHLLH  300
ASVPKMEHHH GGPDTASFGN LLCGVDEPPP FWPWADHQQF N
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174182RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.15e-79HD-ZIP family protein