PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC4AG002260.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 344aa    MW: 37696.9 Da    PI: 6.7321
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC4AG002260.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.4e-18129182356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  TRIDC4AG002260.2 129 KKRRLNVEQVRTLEKNFEVANKLEPERKMQLARALGLQPRQVAIWFQNRRARWK 182
                       4568999**********************************************9 PP

2HD-ZIP_I/II130.56.7e-42128218191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       ekkrrl+ eqv++LE++Fe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy++Lkr++da+k+en++L +++++L++e+
  TRIDC4AG002260.2 128 EKKRRLNVEQVRTLEKNFEVANKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDVLKRQFDAVKAENDALLSHNKKLQSEI 218
                       69**************************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    
KKPMASNGMA SSPSAFFPPN FLLHMQQAPP QHDPSQEHHQ QHHHHHHHEX XXXXXXXXXX  60
XNPFLPSPQC PSLQDFRGGL SPMLGKRPAM YGGGGDGGCG GDEVTGGGGG GGANEEETSD  120
DGSQLGGEKK RRLNVEQVRT LEKNFEVANK LEPERKMQLA RALGLQPRQV AIWFQNRRAR  180
WKTKQLEKDY DVLKRQFDAV KAENDALLSH NKKLQSEILG LKGCREAASE LINLNKETEA  240
SCSNRSENSS EINLDISRTP PSDGPMDAPP SHQQGGGSGG GMIPFYPSVA RPSAGVDIDH  300
LLHASVPKME HHHGGPDTAS FGNLLCGVDE PPPFWPWADH QQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177185RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.17e-80HD-ZIP family protein