PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3BG071140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 119aa    MW: 13348.8 Da    PI: 7.9056
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3BG071140.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer87.61.3e-2745101360
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                        vrY+eC++NhA+ +G +avDGC+Ef+   g + +aa l CaACgCHRnFHRrev++e
  TRIDC3BG071140.1  45 YVRYRECQRNHAIGIGRYAVDGCQEFTVLMGVD-EAAMLLCAACGCHRNFHRREVVNE 101
                       589*************************97776.9999****************9875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    
KAWQQSYSYY HLFSPSNFRL APNMGSRQDQ PAVNGEQGNG AGAAYVRYRE CQRNHAIGIG  60
RYAVDGCQEF TVLMGVDEAA MLLCAACGCH RNFHRREVVN EFGADYHAPR TPPANENRH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.11e-21ZF-HD family protein