PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3BG053080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 549aa    MW: 60435.7 Da    PI: 8.5856
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3BG053080.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.82.8e-164599256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      r+ ++++++q+++Le +F  + +p++++r  +++++gLt +qVk+WFqN+R+ +k
  TRIDC3BG053080.1 45 RRLQRLNPQQTQVLEGFFGICAHPDENQRMGMSESTGLTMQQVKFWFQNKRTHMK 99
                      6667899*********************************************998 PP

2START102.76.1e-331984121203
                       HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....... CS
             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....... 77 
                       ela++a+ e+v + +++ p+W+ ++    + +n++ + q+f  + +     + +ea ra g+v m++ + v  ++d+  +++  ++       
  TRIDC3BG053080.1 198 ELAQSAMHEFVVLSESGGPLWMPVPggslDVLNKMAYAQTFGAGSSanaigFMTEATRADGMVMMDAKQIVDYIMDSE-CYTSFCPglvtsan 289
                       57899************************************77666999*******************9999999999.******99999555 PP

                       EEEEEEEECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
             START  78 kaetlevissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                         ++++  +s+   ga +lm+ e++++splvp R+ +fvR++r ++ g+ +ivdvS+d+ +         ++++ pSgili+++    s+vt+
  TRIDC3BG053080.1 290 TTKVYKWPTSAgynGAMHLMTVETVFPSPLVPsRKCTFVRCCRDMQNGTVIIVDVSLDNGDGT------FKCHKMPSGILIRSLNSDASQVTV 376
                       555555555658***********************************************9995......68********************** PP

                       EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
             START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                       vehv +++  +h+l+r+ + sgl++ga++wv+   rq
  TRIDC3BG053080.1 377 VEHVQVNDTGVHELYRPSL-SGLMFGARRWVSSIVRQ 412
                       *****************98.699********876665 PP

Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    
MTGNRGGRRR KAPQQGRRAR DNDLDISQSN SDGQDGAEGS QQPKRRLQRL NPQQTQVLEG  60
FFGICAHPDE NQRMGMSEST GLTMQQVKFW FQNKRTHMKH VTGKEETYRM KAQNEMLREE  120
NKRLASAAKT AFCPACVALP GLNPSVEVQR LRQENESLKQ QLSQLRAEAH PSSSRPFQLD  180
PSTENIIGRE NDMDAIAELA QSAMHEFVVL SESGGPLWMP VPGGSLDVLN KMAYAQTFGA  240
GSSANAIGFM TEATRADGMV MMDAKQIVDY IMDSECYTSF CPGLVTSANT TKVYKWPTSA  300
GYNGAMHLMT VETVFPSPLV PSRKCTFVRC CRDMQNGTVI IVDVSLDNGD GTFKCHKMPS  360
GILIRSLNSD ASQVTVVEHV QVNDTGVHEL YRPSLSGLMF GARRWVSSIV RQSARMRDLF  420
IVSKSASNGN TNGRKTLMKI ADGLLADYAS GIAAVPGSGW TILRGAGTED DIRITYRKNN  480
DDSNNAVVSV CASFHLPVPL KVTFDLLKNN LLRPKVCTHV MFGMCSSPLS AASHVCTNAM  540
FYSHSGMYW
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-89HD-ZIP family protein