PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3BG049870.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 230aa    MW: 24895.4 Da    PI: 8.7424
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3BG049870.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.54e-2290145156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       r++ +++t+eq++++e++F+++++p++++r++L+k+lgL+ rqVk+WFqNrR++ k
  TRIDC3BG049870.4  90 RKSYHRHTSEQVRVMEAVFKESPHPDEKQRQQLSKQLGLSPRQVKFWFQNRRTQIK 145
                       788999**********************************************9877 PP

2HD-ZIP_I/II668.5e-2294172482
       HD-ZIP_I/II   4 rrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                       +r ++eqv+++E  F+e+ + + +++++l+++Lgl+prqv+ WFqnrR  +k+ q  ++ + Lk+++++l++en+++++
  TRIDC3BG049870.4  94 HRHTSEQVRVMEAVFKESPHPDEKQRQQLSKQLGLSPRQVKFWFQNRRTQIKATQERHENSLLKSELENLQKENRAMRQ 172
                       5889***********************************************************************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    
MGSSRPRTKD FFAAPTLSLS LAGAFARNAP SGDEVEEGEE GSGGVRSGPP GEEVEISSEN  60
TGPAGSQSGD GSAEEEEGHG DGGKRKKRSR KSYHRHTSEQ VRVMEAVFKE SPHPDEKQRQ  120
QLSKQLGLSP RQVKFWFQNR RTQIKATQER HENSLLKSEL ENLQKENRAM RQLAKGPSRC  180
PSCGAAAAST DGFNAAAANQ EQLLQLENAK LRAEVEKLRG ALGTAAADRA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.18e-40HD-ZIP family protein