PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3BG012270.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 322aa    MW: 34447.2 Da    PI: 10.8941
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3BG012270.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.64.6e-3184136458
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       +rY+eCl+NhAa++G+h++DGCgEfmps+g+   +aal CaACgCHR+FHRre++
  TRIDC3BG012270.3  84 WRYRECLRNHAARMGAHVLDGCGEFMPSPGDG--PAALACAACGCHRSFHRREPV 136
                       69**************************8887..******************986 PP

2Homeobox14.46.4e-05228284153
                       TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       +r Rt+ft+eq e++ e+ +    + ++p+        +++g++ r+ kvW +N + 
  TRIDC3BG012270.3 228 KRFRTKFTPEQKERMLEFAHrvgwRVQKPDGGVVDAFCAQVGVPRRVLKVWMHNNKH 284
                       789*********98765444688789****************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    
PPGFLLPQHQ HPHRRRVDRE REKERTLEAP GEAHRQQQQE PARNGVLGGG TMPPPPPTLA  60
IMTGGATRAP GEHGGVSGPE PLPWRYRECL RNHAARMGAH VLDGCGEFMP SPGDGPAALA  120
CAACGCHRSF HRREPVVMVP SPSPSPASAV VSPSATPAGA NSRLMPLLLA PPHMQQKRPH  180
VPASPMSAPA ALAESSSGEL RAPPPPPPPQ AQAAVGGSAS APPAPSKKRF RTKFTPEQKE  240
RMLEFAHRVG WRVQKPDGGV VDAFCAQVGV PRRVLKVWMH NNKHLAKTSA TSPQPLPPLH  300
HDPSPPHHQH HPAPPHQQQH GA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.14e-24ZF-HD family protein