PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3BG012270.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 338aa    MW: 36595.5 Da    PI: 11.019
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3BG012270.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.55e-31100152458
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       +rY+eCl+NhAa++G+h++DGCgEfmps+g+   +aal CaACgCHR+FHRre++
  TRIDC3BG012270.2 100 WRYRECLRNHAARMGAHVLDGCGEFMPSPGDG--PAALACAACGCHRSFHRREPV 152
                       69**************************8887..******************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    
LPQHQHPHRR RVDREREKER TLEAPGEAHR QQQQPQPQHQ QRHQEPQPQH QQRHQEPARN  60
GVLGGGTMPP PPPTLAIMTG GATRAPGEHG GVSGPEPLPW RYRECLRNHA ARMGAHVLDG  120
CGEFMPSPGD GPAALACAAC GCHRSFHRRE PVVMVPSPSP SPASAVVSPS ATPAGANSRL  180
MPLLLAPPHM QQKRPHVPAS PMSAPAALAE SSSGELRAPP PPPPPQAQAA VGGSASAPPA  240
PSKKRFRTKF TPEQKERMLE FAHRVGWRVQ KPDGGVVDAF CAQVGVPRRV LKVWMHNNKH  300
LAKTSATSPQ PLPPLHHDPS PPHHQHHPAP PHQQQHGA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.15e-24ZF-HD family protein