PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3AG046810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 683aa    MW: 74918.2 Da    PI: 7.7016
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3AG046810.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.91.3e-164498256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      r+ +++t++q+++Le +F  + +p++++r  +++++gLt +qVk+WFqN+R+ +k
  TRIDC3AG046810.1 44 RRLQRLTPQQTQVLEGFFGICAHPDENQRMGMSESTGLTMQQVKFWFQNKRTHMK 98
                      666899**********************************************998 PP

2START93.44.5e-301974121203
                       HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...... CS
             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla...... 77 
                       ela++a+ e+v +a+a+ p+W+ ++    + +n++ + q+f    +      + +ea ra  +v m++ + v  ++d+  +++  ++      
  TRIDC3AG046810.1 197 ELAQSAMHEFVVLAEAGGPLWMPVPggsfDVLNKMAYAQTFGARSSanvilgFMTEATRADDMVMMDAKQIVDYIMDSE-CYTSFCPglltsa 288
                       57999************************************66555899***9****************9999999999.9999999999966 PP

                       .EEEEEEEECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
             START  78 .kaetlevissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                          ++++  +s+   ga +l + e++++splvp R+ +fvR++r ++ g+ +ivdvS+d+ +        v++++ pSg l++++    s+vt
  TRIDC3AG046810.1 289 nTTKIYKWPTSAgynGAMHLVTVETVFPSPLVPsRKCTFVRCCRDMQNGTVIIVDVSLDNGDGT------VKCHKMPSGVLVRSLNSDASQVT 375
                       6666667777769**********************************************99984......79********************* PP

                       EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
             START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                       ++ehv +++   h+l+r+ + sgl++ga++wv+   rq
  TRIDC3AG046810.1 376 VIEHVQVNDTGLHELYRPSL-SGLMFGARRWVSSIVRQ 412
                       ******************98.699********876665 PP

Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    
MTGNHGGRRR KAPQQDRPAR DNDLDISQGN SDGQDGAEGS QPKRRLQRLT PQQTQVLEGF  60
FGICAHPDEN QRMGMSESTG LTMQQVKFWF QNKRTHMKHV TGKEETYRMK AQNEMLREEN  120
KRLASAAKTS FCPSCVALPG LSPSGEVQRL RQENEQLKQQ LSQLRAEAHP SSSRPFQLDP  180
SMENITGREN DMDAIAELAQ SAMHEFVVLA EAGGPLWMPV PGGSFDVLNK MAYAQTFGAR  240
SSANVILGFM TEATRADDMV MMDAKQIVDY IMDSECYTSF CPGLLTSANT TKIYKWPTSA  300
GYNGAMHLVT VETVFPSPLV PSRKCTFVRC CRDMQNGTVI IVDVSLDNGD GTVKCHKMPS  360
GVLVRSLNSD ASQVTVIEHV QVNDTGLHEL YRPSLSGLMF GARRWVSSIV RQSARMRDLF  420
VVSKSASNGN TNGRKTLMKI ADGLLAGYAS GIAAVPGGGW TILRGAGTED DIRISYRRNN  480
DDSNTAIVSV CASFHLPVPH RVTFDLLKNN LLRPKWDVLV NGNSVREEVA VCKGVGGGID  540
DVVSILHLKD PPTGENRDNI MILQNSSYDV SGAFMVYCPV NIQLMNEIMS PSDTAESNKV  600
SLYPTGFYLL PVEDTALGLG EDGATLVTVG FQIMLKLARG TGLYPRSAST AVGLMTENIA  660
TIKKTLTSSH PIFYRRQPPN NFI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-103HD-ZIP family protein