PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3AG043920.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 216aa    MW: 23300.7 Da    PI: 6.0594
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3AG043920.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.54.1e-2276131156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       r++ +++t+eq++++e++F+++++p++++r++L+k+lgL+ rqVk+WFqNrR++ k
  TRIDC3AG043920.5  76 RKSYHRHTAEQVRVMEAVFKESPHPDEKQRQQLSKQLGLSPRQVKFWFQNRRTQIK 131
                       788999**********************************************9877 PP

2HD-ZIP_I/II668.8e-2280158482
       HD-ZIP_I/II   4 rrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                       +r ++eqv+++E  F+e+ + + +++++l+++Lgl+prqv+ WFqnrR  +k+ q  ++ + Lk+++++l++en+++++
  TRIDC3AG043920.5  80 HRHTAEQVRVMEAVFKESPHPDEKQRQQLSKQLGLSPRQVKFWFQNRRTQIKATQERHENSLLKSELENLQKENRAMRQ 158
                       5889***********************************************************************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    
MIELWVQAGA FARNAPSGDE VEEGEEGSGG IIGGPPGEEV EISSADTGPA GSQSGDGSGE  60
EEEGHADGGK RKKRSRKSYH RHTAEQVRVM EAVFKESPHP DEKQRQQLSK QLGLSPRQVK  120
FWFQNRRTQI KATQERHENS LLKSELENLQ KENRAMRQLA KGPSRCPSCG AAAASTDGFD  180
AAAANQEQLL QLENAKLRAE VEKLRGALGT AAADGA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.14e-33HD-ZIP family protein