PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3AG043920.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 670aa    MW: 73162 Da    PI: 8.2023
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3AG043920.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.71.7e-172431556
                      HHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox 15 LeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      L+ +F+++++p++++r++L+k+lgL+ rqVk+WFqNrR++ k
  TRIDC3AG043920.3  2 LNMVFKESPHPDEKQRQQLSKQLGLSPRQVKFWFQNRRTQIK 43
                      899***********************************9877 PP

2START186.91.1e-581794061206
                       HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                       ela +a++el ++ +++ep+Wv+s+    +++n+de+++ f ++++        s+ea+r++gvv  ++++lv  ++d++ qW+e ++    k
  TRIDC3AG043920.3 179 ELAGRALEELKTMSSSGEPLWVRSVetgrDILNYDEYVRLFRRDDGpgdrrasWSVEASRETGVVYLDATNLVHAFMDVN-QWKELFPsmvsK 270
                       578999*************************************999******99**************************.****9999999* PP

                       EEEEEEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
             START  79 aetlevissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                       a+tl+vi++g       ga+qlm+ae q+l+p+vp R+f+f+Ry+++l a++w++vdvS d  +    +s++v + + pSg++ie+  nghs+
  TRIDC3AG043920.3 271 ASTLDVIRTGddddvhdGAVQLMFAEVQMLTPMVPtREFYFARYCKKLAAEKWAVVDVSFDKAEADVGTSPLVTCWKNPSGCIIEEQTNGHSR 363
                       ***************************************************************99999************************* PP

                       EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       vtwveh+ +++  +++++r +  sgla+ga++wvatlq qce+
  TRIDC3AG043920.3 364 VTWVEHTRCRECAVPSMYRAVTASGLAFGARRWVATLQLQCER 406
                       *****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    
MLNMVFKESP HPDEKQRQQL SKQLGLSPRQ VKFWFQNRRT QIKATQERHE NSLLKSELEN  60
LQKENRAMRQ LAKGPSRCPS CGAAAASTDG FDAAAANQEQ LLQLENAKLR AEVLMLWKWN  120
PFQVEKLRGA LGTAAADGAA SPAFSPPFSA ATAQMSGNRS PFEVYGAGFV GRDRQSVLEL  180
AGRALEELKT MSSSGEPLWV RSVETGRDIL NYDEYVRLFR RDDGPGDRRA SWSVEASRET  240
GVVYLDATNL VHAFMDVNQW KELFPSMVSK ASTLDVIRTG DDDDVHDGAV QLMFAEVQML  300
TPMVPTREFY FARYCKKLAA EKWAVVDVSF DKAEADVGTS PLVTCWKNPS GCIIEEQTNG  360
HSRVTWVEHT RCRECAVPSM YRAVTASGLA FGARRWVATL QLQCERMVFW VATNVPTRDS  420
NGVSTLAGRR SVLKLAHRMT SSLCRVIGGS RGLAWSRAPR AGAGDVRLTS RTNAGDPGEP  480
QGLIACAVLS TWLPVSPTSL LDFLRDESRR PEWDVTLAGR AVQRRVNLTK GKDRCNCVTA  540
YVSSRADEQG GEWIVQDSCT NPCESIVAYA PVDAAVLQPV IRGHDSSGVA LLPCGFAVVP  600
DGLESRPAVI TSRKEDGAVA GAGSLVTVAF QVLASSSPAA ALSPESAETV TSLASCTLRR  660
VKKALGCQDR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.11e-174HD-ZIP family protein