PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3AG034640.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 152aa    MW: 16570.7 Da    PI: 7.3531
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3AG034640.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18101152354
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k+ +++keq + Lee F+ n+++s +++e LA kl+L  rqV vWFqNrRa+
  TRIDC3AG034640.3 101 KKLRLSKEQSRLLEESFRLNHTLSPKQKEALAIKLKLRPRQVEVWFQNRRAR 152
                       67789*********************************************98 PP

2HD-ZIP_I/II76.54.5e-25101152253
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRAR 53 
                       kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRAR
  TRIDC3AG034640.3 101 KKLRLSKEQSRLLEESFRLNHTLSPKQKEALAIKLKLRPRQVEVWFQNRRAR 152
                       9**************************************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    
LLLSPSSSPF PCSCFRIGLS PVMGATSPSG LELTMAVPGL SSSSGSEGFV CNNNISNNGG  60
GNMRDLDMNQ PASGGEEEDF LMGGVEEDEE ERGAGGPHRP KKLRLSKEQS RLLEESFRLN  120
HTLSPKQKEA LAIKLKLRPR QVEVWFQNRR AR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70920.14e-29HD-ZIP family protein