PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3AG034640.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 223aa    MW: 24881.3 Da    PI: 9.1494
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3AG034640.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.2e-1980133356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+ +++keq + Lee F+ n+++s +++e LA kl+L  rqV vWFqNrRa+ k
  TRIDC3AG034640.2  80 KKLRLSKEQSRLLEESFRLNHTLSPKQKEALAIKLKLRPRQVEVWFQNRRARTK 133
                       67789***********************************************98 PP

2HD-ZIP_I/II119.61.6e-3880167289
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRARtk+k++E+++e+Lkr++ +l+een+rL++eveeLr+
  TRIDC3AG034640.2  80 KKLRLSKEQSRLLEESFRLNHTLSPKQKEALAIKLKLRPRQVEVWFQNRRARTKLKHTEMECEYLKRCFGSLTEENRRLQREVEELRA 167
                       9*************************************************************************************94 PP

Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    
VMGATSPSGL ELTMAVPGLS SSSGSEGFVC NNNISNNGGG NMRDLDMNQP ASGGEEEDFL  60
MGGVEEDEEE RGAGGPHRPK KLRLSKEQSR LLEESFRLNH TLSPKQKEAL AIKLKLRPRQ  120
VEVWFQNRRA RTKLKHTEME CEYLKRCFGS LTEENRRLQR EVEELRAMRM APPTVLSPHT  180
RQPLPASALT MCPRCERVTA ATCPRITRPA ASPFHPRRPS AAF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.12e-64HD-ZIP family protein