PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC3AG003030.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 225aa    MW: 24742.2 Da    PI: 8.9793
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC3AG003030.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.8e-1983137256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++tk+q+  Le++F++++++s+++++ LA++l+L  rqV vWFqNrRa+ k
  TRIDC3AG003030.2  83 RKKLRLTKDQTALLEDHFKEQSTLSHKQKASLARQLSLRPRQVEVWFQNRRARTK 137
                       78889************************************************98 PP

2HD-ZIP_I/II118.73.1e-3883171190
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                       +kk+rl+k+q +lLE++F+e+++L++++K++lar+L l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL++e ++Lr +
  TRIDC3AG003030.2  83 RKKLRLTKDQTALLEDHFKEQSTLSHKQKASLARQLSLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCETLMEENRRLHRELQHLR-A 171
                       69*************************************************************************************9.4 PP

Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    
MFMAHEEAGL ALGLSLGSGA GHHHHLLQPK EAAPPEPCLS LRLAGAGTVK REEEERALIY  60
CSAASSAADD LVEGYNSGGG GSRKKLRLTK DQTALLEDHF KEQSTLSHKQ KASLARQLSL  120
RPRQVEVWFQ NRRARTKLKQ TEVDCELLKR CCETLMEENR RLHRELQHLR ALHHHQHHHP  180
AAAFFIPSAA TVASVCPSCS GAPPAHAADR PATKRTFFAT KSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18288SRKKLRL
2132140RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-42HD-ZIP family protein