PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2BG060870.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 715aa    MW: 77859.6 Da    PI: 6.9822
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2BG060870.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.3e-181061657
                      S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      ++t+ q++eL++lFe++++p++++r+ L k+++L+ +qVk+WFqNrR++ k+
  TRIDC2BG060870.2 10 RHTPRQIQELQALFEQCPHPDEKQRAALGKRVRLQPSQVKFWFQNRRTQLKR 61
                      689*********************************************9997 PP

2START144.69.3e-462024572203
                       HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHH.HHHHHHCCCGG.......... CS
             START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmvla.llveellddke.......... 70 
                       la +a++elvk+a+ +ep+W   +        e +n +++ ++f++s +     + +ea+r+sg+v  +   +lve+lld  +          
  TRIDC2BG060870.2 202 LATSAMDELVKMAQMDEPLWIPNVplpgslakETLNHEVYSRTFSPSIGvkppgFVSEASRESGIVSSDGSvELVETLLDEVAlvslsllfpv 294
                       7889*****************999999********************99****************98774449******************** PP

                       ..............CT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--. CS
             START  71 ..............qWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe 138
                                     +W++ +     + +++e is+g      gal lm+a+lq+lsplvp R++ f+R+++qlg+g w++vdvS+d   + + 
  TRIDC2BG060870.2 295 rlnlhclleillqrRWSRFFSciiaESSIIEEISTGaagsrdGALLLMQAKLQVLSPLVPvREVAFLRFCKQLGEGLWAVVDVSIDGLGMEQG 387
                       ************999*99999*****************************************************************8888776 PP

                       .....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
             START 139 .....sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                            +   + +++lpSg+++++++ng +kvtwveh+ + ++++h+l+r+l++sgla ga +w+atlqrq
  TRIDC2BG060870.2 388 lavasTTANMNCRRLPSGCVVQDTPNGFCKVTWVEHTVYHESSVHQLYRPLLRSGLALGAGRWLATLQRQ 457
                       666667788999********************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    
GKRKRPSNAR HTPRQIQELQ ALFEQCPHPD EKQRAALGKR VRLQPSQVKF WFQNRRTQLK  60
RESLLHENRQ LMEENGKLRA ENLSLREAMT HPVCGGCGGP FPAMLDESPS LEEDLRVQNA  120
TLKNELSRFC ALASVFLGRS ISFVAAPPTP GSPVERIGSV PATTVANSTV TEFTGSPSSQ  180
TMGMAITTMA KAGIDRSVFL ELATSAMDEL VKMAQMDEPL WIPNVPLPGS LAKETLNHEV  240
YSRTFSPSIG VKPPGFVSEA SRESGIVSSD GSVELVETLL DEVALVSLSL LFPVRLNLHC  300
LLEILLQRRW SRFFSCIIAE SSIIEEISTG AAGSRDGALL LMQAKLQVLS PLVPVREVAF  360
LRFCKQLGEG LWAVVDVSID GLGMEQGLAV ASTTANMNCR RLPSGCVVQD TPNGFCKVTW  420
VEHTVYHESS VHQLYRPLLR SGLALGAGRW LATLQRQFDC LDVLMPKQDS SDAMLEGSRS  480
LLRLAERMMD NFCAGVSASS AEWSKLDGFT GSIGEDVRIM ARRSVDEPGV PAGVVLCAAT  540
SVWMLVTPKR LFNFLCNERT RVEWDILSKG GPMQEVTKIY KGQQNGNAVS LLKATAPNTQ  600
QDSSILILQE TCTDASSSTV VYSPVDIPAM RRVMGGEGDP TSIMLLPSGF VILPGGPSMS  660
GDDGHKTCGS LLTVAFQILG NRQPTGKLTV ELVQTVDSLI SCTINRIKMA LRCDA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0HD-ZIP family protein