PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2BG060870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 782aa    MW: 84255.1 Da    PI: 6.2165
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2BG060870.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.1e-18102153657
                       S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       ++t+ q++eL++lFe++++p++++r+ L k+++L+ +qVk+WFqNrR++ k+
  TRIDC2BG060870.1 102 RHTPRQIQELQALFEQCPHPDEKQRAALGKRVRLQPSQVKFWFQNRRTQLKR 153
                       689*********************************************9997 PP

2START157.69.8e-502945242203
                       HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHH.HHHHHHCCCGGCT-TT-S... CS
             START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmvla.llveellddkeqWdetla... 77 
                       la +a++elvk+a+ +ep+W   +        e +n +++ ++f++s +     + +ea+r+sg+v  +   +lve+lld + +W++ +    
  TRIDC2BG060870.1 294 LATSAMDELVKMAQMDEPLWIPNVplpgslakETLNHEVYSRTFSPSIGvkppgFVSEASRESGIVSSDGSvELVETLLDER-RWSRFFScii 385
                       7889*****************999999********************99****************98775448*********.*******99* PP

                       .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEE CS
             START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepk 157
                        + +++e is+g      gal lm+a+lq+lsplvp R++ f+R+++qlg+g w++vdvS+d   + +      +   + +++lpSg++++++
  TRIDC2BG060870.1 386 aESSIIEEISTGaagsrdGALLLMQAKLQVLSPLVPvREVAFLRFCKQLGEGLWAVVDVSIDGLGMEQGlavasTTANMNCRRLPSGCVVQDT 478
                       **************************************************************8888776666667788999************ PP

                       CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
             START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                       +ng +kvtwveh+ + ++++h+l+r+l++sgla ga +w+atlqrq
  TRIDC2BG060870.1 479 PNGFCKVTWVEHTVYHESSVHQLYRPLLRSGLALGAGRWLATLQRQ 524
                       ********************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    
MPREKGMAFW GFFDGNDGGP APDVNGFPYY SAAGPGALAS SSLSPPSCLA PGRGGVKEEN  60
GSRSMTDHLH AVSGGDVGGG EDGEAAPELG HHGKRKRPSN ARHTPRQIQE LQALFEQCPH  120
PDEKQRAALG KRVRLQPSQV KFWFQNRRTQ LKRESLLHEN RQLMEENGKL RAENLSLREA  180
MTHPVCGGCG GPFPAMLDES PSLEEDLRVQ NATLKNELSR FCALASVFLG RSISFVAAPP  240
TPGSPVERIG SVPATTVANS TVTEFTGSPS SQTMGMAITT MAKAGIDRSV FLELATSAMD  300
ELVKMAQMDE PLWIPNVPLP GSLAKETLNH EVYSRTFSPS IGVKPPGFVS EASRESGIVS  360
SDGSVELVET LLDERRWSRF FSCIIAESSI IEEISTGAAG SRDGALLLMQ AKLQVLSPLV  420
PVREVAFLRF CKQLGEGLWA VVDVSIDGLG MEQGLAVAST TANMNCRRLP SGCVVQDTPN  480
GFCKVTWVEH TVYHESSVHQ LYRPLLRSGL ALGAGRWLAT LQRQFDCLDV LMPKQDSSDA  540
MLEGSRSLLR LAERMMDNFC AGVSASSAEW SKLDGFTGSI GEDVRIMARR SVDEPGVPAG  600
VVLCAATSVW MLVTPKRLFN FLCNERTRVE WDILSKGGPM QEVTKIYKGQ QNGNAVSLLK  660
ATAPNTQQDS SILILQETCT DASSSTVVYS PVDIPAMRRV MGGEGDPTSI MLLPSGFVIL  720
PGGPSMSGDD GHKTCGSLLT VAFQILGNRQ PTGKLTVELV QTVDSLISCT INRIKMALRC  780
DA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0HD-ZIP family protein