PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2BG058690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 196aa    MW: 21615 Da    PI: 10.1048
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2BG058690.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.88.9e-1958111356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq e Le  F+++r++ + ++  LA++lgL+ +qV vWFqNrRa++k
  TRIDC2BG058690.1  58 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHK 111
                       45689***********************************************99 PP

2HD-ZIP_I/II109.81.9e-3558149293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl++eq+++LE sF+ee+kLe+ rKv la eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++L+++v +L+e+l++
  TRIDC2BG058690.1  58 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHKSKTLEQEFTRLKHAHDADILHKCHLQNQVLRLKERLRA 149
                       9**************************************************************************************99975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    
MDNQQLFGSS YVDAPFFAAN GTAQRESQPK ARRRRRKAAR CGGGDGNGGE MDGGGDPKKR  60
RLTDEQAEML ELSFREERKL ETGRKVYLAA ELGLDPKQVA VWFQNRRARH KSKTLEQEFT  120
RLKHAHDADI LHKCHLQNQV LRLKERLRAT EEEVQRLRSA AGSHGASGDG GDAAGAVSVC  180
GGSPGSSFST GTWQQH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-37HD-ZIP family protein