PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2BG058680.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 223aa    MW: 24467.2 Da    PI: 7.8597
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2BG058680.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-1860113356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq e Le  F+++r++ + ++  LA++lgL+ +qV vWFqNrRa++k
  TRIDC2BG058680.2  60 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHK 113
                       45689***********************************************99 PP

2HD-ZIP_I/II110.31.3e-3560151293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl++eq+++LE sF+ee+kLe+ rKv la eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++L++ev +L+e+l++
  TRIDC2BG058680.2  60 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHKSKTLEQEFTRLKHAHDADILHKCHLQNEVLRLKERLRA 151
                       9**************************************************************************************99975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    
MDNQQLFGSS YVDAPFFAAN GTCTAQRESQ PKARRRRRKA ARCGGGDGNG GEMDGGGDPK  60
KRRLTDEQAE MLELSFREER KLETGRKVYL AAELGLDPKQ VAVWFQNRRA RHKSKTLEQE  120
FTRLKHAHDA DILHKCHLQN EVLRLKERLR ATEEEVQRLR SAAGSHGASG DGGDAAGAVS  180
VCGGSPGSSF STGTWQQHLG FSGANELGPD DDLMMCVPDC FFA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.17e-38HD-ZIP family protein