PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2BG058680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 240aa    MW: 26312.3 Da    PI: 9.0271
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2BG058680.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1863116356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq e Le  F+++r++ + ++  LA++lgL+ +qV vWFqNrRa++k
  TRIDC2BG058680.1  63 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHK 116
                       45689***********************************************99 PP

2HD-ZIP_I/II109.91.7e-3563154293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl++eq+++LE sF+ee+kLe+ rKv la eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++L++ev +L+e+l++
  TRIDC2BG058680.1  63 KKRRLTDEQAEMLELSFREERKLETGRKVYLAAELGLDPKQVAVWFQNRRARHKSKTLEQEFTRLKHAHDADILHKCHLQNEVLRLKERLRA 154
                       9**************************************************************************************99975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    
LRTAGMDNQQ LFGSSYVDAP FFAANGTAQR ESQPKARRRR RKAARCGGGD GNGGEMDGGG  60
DPKKRRLTDE QAEMLELSFR EERKLETGRK VYLAAELGLD PKQVAVWFQN RRARHKSKTL  120
EQEFTRLKHA HDADILHKCH LQNEVLRLKE RLRATEEEVQ RLRSAAGSHG ASGDGGDAAG  180
AVSVCGGSPG SSFSTGTWQQ HLGFSGANEL GPDDDLMMAA ESGNTSRNHL SRRISCCYLL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-37HD-ZIP family protein