PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC2BG038350.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 43aa MW: 4799.53 Da PI: 7.442 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 54.1 | 6.6e-17 | 3 | 41 | 24 | 62 |
YABBY 24 vsvPstslfkvvtvrCGhCtsllsvnlakasqllaaesh 62 v+vP+++++++vtvrCGhCt++ls++l ++q+++a++h TRIDC2BG038350.2 3 VNVPNNCSYNIVTVRCGHCTMVLSMDLGPFHQARTAQEH 41 9***********************************998 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 43 aa Download sequence |
MPVNVPNNCS YNIVTVRCGH CTMVLSMDLG PFHQARTAQE HQV |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 1e-06 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC2BG038350.2 |