PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2BG029060.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 223aa    MW: 24173 Da    PI: 10.2741
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2BG029060.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-1886138456
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++t+eq++ Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  TRIDC2BG029060.4  86 KRRLTDEQVHGLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHK 138
                       5689***********************************************99 PP

2HD-ZIP_I/II106.61.9e-3485174291
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       kkrrl++eqv+ LE sF+ee+kLe+ rKv+la eLgl+p+qvavWFqnrRAR+k+k +E+++++Lk+a+da   ++++   +v +L+e+l
  TRIDC2BG029060.4  85 KKRRLTDEQVHGLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHKSKLMEEEFAKLKHAHDAAILHKCHTYGQVLRLKERL 174
                       9*****************************************************************************999999999887 PP

Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    
TQHNPPGLPS NLPTTPLLSS PQLPTASMDK QQVFGSSYVD MPFFAANGTA QGESRPRARR  60
RRRRAARCGR GDGDGGEMDG GGDLKKRRLT DEQVHGLELS FREERKLETG RKVHLAAELG  120
LDPKQVAVWF QNRRARHKSK LMEEEFAKLK HAHDAAILHK CHTYGQVLRL KERLGATEEE  180
VRRLRSAAGS HGASGDGGDA AGAVGACGGS PSSSFSTGTC QQH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15564RPRARRRRRR
25964RRRRRR
35967RRRRRRAAR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66700.14e-37HD-ZIP family protein