PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2BG029060.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 238aa    MW: 25905 Da    PI: 7.5636
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2BG029060.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-1861113456
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++t+eq++ Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  TRIDC2BG029060.3  61 KRRLTDEQVHGLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHK 113
                       5689***********************************************99 PP

2HD-ZIP_I/II113.81.1e-3660149291
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       kkrrl++eqv+ LE sF+ee+kLe+ rKv+la eLgl+p+qvavWFqnrRAR+k+k +E+++++Lk+a+da   ++++Le+ev +L+e+l
  TRIDC2BG029060.3  60 KKRRLTDEQVHGLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHKSKLMEEEFAKLKHAHDAAILHKCHLENEVLRLKERL 149
                       9**************************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    
MDKQQVFGSS YVDMPFFAAN GAATAQGESR PRARRRRRRA ARCGRGDGDG GEMDGGGDLK  60
KRRLTDEQVH GLELSFREER KLETGRKVHL AAELGLDPKQ VAVWFQNRRA RHKSKLMEEE  120
FAKLKHAHDA AILHKCHLEN EVLRLKERLG ATEEEVRRLR SAAGSHGASG DGGDAAGAVG  180
ACGGSPSSSF STGTCQQHPG FSGADVLGPD DDLMMCVPEY CGYADSSVVE WFSLYGLI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13039RPRARRRRRR
23439RRRRRR
33442RRRRRRAAR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-38HD-ZIP family protein