PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2BG029060.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 186aa    MW: 20247.7 Da    PI: 6.4168
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2BG029060.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.8e-19961456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      ++++t+eq++ Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  TRIDC2BG029060.2  9 KRRLTDEQVHGLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHK 61
                      5689***********************************************99 PP

2HD-ZIP_I/II114.65.9e-37897291
       HD-ZIP_I/II  2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91
                      kkrrl++eqv+ LE sF+ee+kLe+ rKv+la eLgl+p+qvavWFqnrRAR+k+k +E+++++Lk+a+da   ++++Le+ev +L+e+l
  TRIDC2BG029060.2  8 KKRRLTDEQVHGLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHKSKLMEEEFAKLKHAHDAAILHKCHLENEVLRLKERL 97
                      9**************************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    
MDGGGDLKKR RLTDEQVHGL ELSFREERKL ETGRKVHLAA ELGLDPKQVA VWFQNRRARH  60
KSKLMEEEFA KLKHAHDAAI LHKCHLENEV LRLKERLGAT EEEVRRLRSA AGSHGASGDG  120
GDAAGAVGAC GGSPSSSFST GTCQQHPGFS GADVLGPDDD LMMCVPEYCG YADSSVVEWF  180
SLYGLI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-40HD-ZIP family protein