PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG066960.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 777aa    MW: 83542.4 Da    PI: 5.7346
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG066960.8genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-20116172157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  TRIDC2AG066960.8 116 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 172
                       688999************************************************995 PP

2START1879.7e-592935121206
                       HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
             START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                       ela +a++el+++a +++p+W + +     ++++e+ + f + ++          +ea+r+ +vv+m++a lve+l+d++ q+   +     +
  TRIDC2AG066960.8 293 ELAVAAMEELLRMARLDDPLWATTVdqaLALDEEEYARMFIDPRGglgpkqygLVSEASRDAAVVIMTPASLVEILMDVN-QYAAVFSsivsR 384
                       57899********************8776688888888886666679*********************************.66666655555* PP

                       EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                       a+tlev+s+g      galq+m+ e+q++splvp R+++fvRy+++  +g w++vdvS+d  q +       +++++pSg+li++ +ng+skv
  TRIDC2AG066960.8 385 AATLEVLSTGvagcydGALQVMSVEFQVPSPLVPtRESYFVRYCKRNADGAWAVVDVSLDGLQGV-------KCRRRPSGCLIQEAPNGYSKV 470
                       ************************************************************99985.......699****************** PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       twvehv++++r++h+++++lv+sgla+ga++wv  l+rqce+
  TRIDC2AG066960.8 471 TWVEHVEVDDRSVHNIYKPLVGSGLAFGARRWVGVLGRQCER 512
                       ****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    
MMIPARHMPS SMIGRSSGGA PYGSSSALSL GQPNLLDGSN QHLLPHHLLE QIPARAAESG  60
DNNNGSVGGG VGMIRGRDSM DPLGDEFESR SGSENVDGDA VDNAEQDQDP NQRPRKKRYH  120
RHTQHQIQEM EAFFKECPHP DDKQRKELSR ELGLEPLQVK FWFQNKRTQM KNQHERHENS  180
QLRADNDKLR AENMRYKEAL SSASCPNCGG PAALGEMSFD EHHLRVENAR LRDEIDRISA  240
IAAKYVGKPM VPFPVLSSPL AAAPGASAYD VFAGAASVLQ APPDDKQQGV VVELAVAAME  300
ELLRMARLDD PLWATTVDQA LALDEEEYAR MFIDPRGGLG PKQYGLVSEA SRDAAVVIMT  360
PASLVEILMD VNQYAAVFSS IVSRAATLEV LSTGVAGCYD GALQVMSVEF QVPSPLVPTR  420
ESYFVRYCKR NADGAWAVVD VSLDGLQGVK CRRRPSGCLI QEAPNGYSKV TWVEHVEVDD  480
RSVHNIYKPL VGSGLAFGAR RWVGVLGRQC ERLASAMASN IPTSDIGVIT SSEGRKSMLK  540
LAERMVASFC GGVTASVAHQ WTTLSGSGAE DVRVMTRKSV DDPGRPPGIV LNAATSFWLP  600
VPPKRVFDFL RDETSRSEWD ILSNGGIVQE MAHIANGRDH GNCVSLLRVN STNSNQSNML  660
ILQESCTDAS GSYVIYAPVD VVAMNVVLNG GDTDYVALLP SGFAILPDGP AGTMHAAAGA  720
TGTGGSLLTV AFQILVDSVP TAKLSLGSVA TVNSLIACTV ERIKTAVISN GGASPPQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0HD-ZIP family protein