PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG066960.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 771aa    MW: 83136 Da    PI: 5.4295
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG066960.7genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-20110166157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  TRIDC2AG066960.7 110 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 166
                       688999************************************************995 PP

2START1879.6e-592875061206
                       HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
             START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                       ela +a++el+++a +++p+W + +     ++++e+ + f + ++          +ea+r+ +vv+m++a lve+l+d++ q+   +     +
  TRIDC2AG066960.7 287 ELAVAAMEELLRMARLDDPLWATTVdqaLALDEEEYARMFIDPRGglgpkqygLVSEASRDAAVVIMTPASLVEILMDVN-QYAAVFSsivsR 378
                       57899********************8776688888888886666679*********************************.66666655555* PP

                       EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                       a+tlev+s+g      galq+m+ e+q++splvp R+++fvRy+++  +g w++vdvS+d  q +       +++++pSg+li++ +ng+skv
  TRIDC2AG066960.7 379 AATLEVLSTGvagcydGALQVMSVEFQVPSPLVPtRESYFVRYCKRNADGAWAVVDVSLDGLQGV-------KCRRRPSGCLIQEAPNGYSKV 464
                       ************************************************************99985.......699****************** PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       twvehv++++r++h+++++lv+sgla+ga++wv  l+rqce+
  TRIDC2AG066960.7 465 TWVEHVEVDDRSVHNIYKPLVGSGLAFGARRWVGVLGRQCER 506
                       ****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    
GLIASMFSGT PLTDDGPKLC FLYKLQPNLL DGSNQHLLPH HLLEQIPARA AESGDNNNGS  60
VGGGVGMIRG RDSMDPLGDE FESRSGSENV DGDAVDNAEQ DQDPNQRPRK KRYHRHTQHQ  120
IQEMEAFFKE CPHPDDKQRK ELSRELGLEP LQVKFWFQNK RTQMKNQHER HENSQLRADN  180
DKLRAENMRY KEALSSASCP NCGGPAALGE MSFDEHHLRV ENARLRDEID RISAIAAKYV  240
GKPMVPFPVL SSPLAAAPGA SAYDVFAGAA SVLQAPPDDK QQGVVVELAV AAMEELLRMA  300
RLDDPLWATT VDQALALDEE EYARMFIDPR GGLGPKQYGL VSEASRDAAV VIMTPASLVE  360
ILMDVNQYAA VFSSIVSRAA TLEVLSTGVA GCYDGALQVM SVEFQVPSPL VPTRESYFVR  420
YCKRNADGAW AVVDVSLDGL QGVKCRRRPS GCLIQEAPNG YSKVTWVEHV EVDDRSVHNI  480
YKPLVGSGLA FGARRWVGVL GRQCERLASA MASNIPTSDI GVITSSEGRK SMLKLAERMV  540
ASFCGGVTAS VAHQWTTLSG SGAEDVRVMT RKSVDDPGRP PGIVLNAATS FWLPVPPKRV  600
FDFLRDETSR SEWDILSNGG IVQEMAHIAN GRDHGNCVSL LRVNSTNSNQ SNMLILQESC  660
TDASGSYVIY APVDVVAMNV VLNGGDTDYV ALLPSGFAIL PDGPAGTMHA AAGATGTGGS  720
LLTVAFQILV DSVPTAKLSL GSVATVNSLI ACTVERIKTA VISNGGASPP Q
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0HD-ZIP family protein