PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG066960.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 434aa    MW: 47412 Da    PI: 6.1929
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG066960.5genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.42.2e-172074357
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      +Rtt  +  ++ L ++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  TRIDC2AG066960.5 20 ERTTGDAAFIQGLRTFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 74
                      6899999999******************************************995 PP

2START188.82.7e-591954141206
                       HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
             START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                       ela +a++el+++a +++p+W + +     ++++e+ + f + ++          +ea+r+ +vv+m++a lve+l+d++ q+   +     +
  TRIDC2AG066960.5 195 ELAVAAMEELLRMARLDDPLWATTVdqaLALDEEEYARMFIDPRGglgpkqygLVSEASRDAAVVIMTPASLVEILMDVN-QYAAVFSsivsR 286
                       57899********************8776688888888886666679*********************************.66666655555* PP

                       EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                       a+tlev+s+g      galq+m+ e+q++splvp R+++fvRy+++  +g w++vdvS+d  q +       +++++pSg+li++ +ng+skv
  TRIDC2AG066960.5 287 AATLEVLSTGvagcydGALQVMSVEFQVPSPLVPtRESYFVRYCKRNADGAWAVVDVSLDGLQGV-------KCRRRPSGCLIQEAPNGYSKV 372
                       ************************************************************99985.......699****************** PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       twvehv++++r++h+++++lv+sgla+ga++wv  l+rqce+
  TRIDC2AG066960.5 373 TWVEHVEVDDRSVHNIYKPLVGSGLAFGARRWVGVLGRQCER 414
                       ****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    
PGPKAERATV SVVLRPSPNE RTTGDAAFIQ GLRTFFKECP HPDDKQRKEL SRELGLEPLQ  60
VKFWFQNKRT QMKNQHERHE NSQLRADNDK LRAENMRYKE ALSSASCPNC GGPAALGEMS  120
FDEHHLRVEN ARLRDEIDRI SAIAAKYVGK PMVPFPVLSS PLAAAPGASA YDVFAGAASV  180
LQAPPDDKQQ GVVVELAVAA MEELLRMARL DDPLWATTVD QALALDEEEY ARMFIDPRGG  240
LGPKQYGLVS EASRDAAVVI MTPASLVEIL MDVNQYAAVF SSIVSRAATL EVLSTGVAGC  300
YDGALQVMSV EFQVPSPLVP TRESYFVRYC KRNADGAWAV VDVSLDGLQG VKCRRRPSGC  360
LIQEAPNGYS KVTWVEHVEV DDRSVHNIYK PLVGSGLAFG ARRWVGVLGR QCERLASAMA  420
SNIPTSDIGG PCVQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0HD-ZIP family protein