PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG066960.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 677aa    MW: 73786.2 Da    PI: 6.1509
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG066960.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-20129185157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  TRIDC2AG066960.4 129 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 185
                       688999************************************************995 PP

2START187.47.5e-593065251206
                       HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
             START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                       ela +a++el+++a +++p+W + +     ++++e+ + f + ++          +ea+r+ +vv+m++a lve+l+d++ q+   +     +
  TRIDC2AG066960.4 306 ELAVAAMEELLRMARLDDPLWATTVdqaLALDEEEYARMFIDPRGglgpkqygLVSEASRDAAVVIMTPASLVEILMDVN-QYAAVFSsivsR 397
                       57899********************8776688888888886666679*********************************.66666655555* PP

                       EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                       a+tlev+s+g      galq+m+ e+q++splvp R+++fvRy+++  +g w++vdvS+d  q +       +++++pSg+li++ +ng+skv
  TRIDC2AG066960.4 398 AATLEVLSTGvagcydGALQVMSVEFQVPSPLVPtRESYFVRYCKRNADGAWAVVDVSLDGLQGV-------KCRRRPSGCLIQEAPNGYSKV 483
                       ************************************************************99985.......699****************** PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       twvehv++++r++h+++++lv+sgla+ga++wv  l+rqce+
  TRIDC2AG066960.4 484 TWVEHVEVDDRSVHNIYKPLVGSGLAFGARRWVGVLGRQCER 525
                       ****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    
FGVRQASSKV ESTMMIPARH MPSSMIGRSS GGAPYGSSSA LSLGQPNLLD GSNQHLLPHH  60
LLEQIPARAA ESGDNNNGSV GGGVGMIRGR DSMDPLGDEF ESRSGSENVD GDAVDNAEQD  120
QDPNQRPRKK RYHRHTQHQI QEMEAFFKEC PHPDDKQRKE LSRELGLEPL QVKFWFQNKR  180
TQMKNQHERH ENSQLRADND KLRAENMRYK EALSSASCPN CGGPAALGEM SFDEHHLRVE  240
NARLRDEIDR ISAIAAKYVG KPMVPFPVLS SPLAAAPGAS AYDVFAGAAS VLQAPPDDKQ  300
QGVVVELAVA AMEELLRMAR LDDPLWATTV DQALALDEEE YARMFIDPRG GLGPKQYGLV  360
SEASRDAAVV IMTPASLVEI LMDVNQYAAV FSSIVSRAAT LEVLSTGVAG CYDGALQVMS  420
VEFQVPSPLV PTRESYFVRY CKRNADGAWA VVDVSLDGLQ GVKCRRRPSG CLIQEAPNGY  480
SKVTWVEHVE VDDRSVHNIY KPLVGSGLAF GARRWVGVLG RQCERLASAM ASNIPTSDIG  540
VITSSEGRKS MLKLAERMVA SFCGGVTASV AHQWTTLSGS GAEDVRVMTR KSVDDPGRPP  600
GIVLNAATSF WLPVPPKRVF DFLRDETSRS EWDILSNGGI VQEMAHIANG RDHGNCVSLL  660
RVNVSTIESD HAITSFV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0HD-ZIP family protein