PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIDC2AG059990.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 131aa    MW: 14494.3 Da    PI: 8.9673
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIDC2AG059990.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.7e-1965116253
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa
  TRIDC2AG059990.2  65 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRSRQVEVWFQNRRA 116
                       788899*********************************************9 PP

2HD-ZIP_I/II78.79.7e-2665116152
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRA 52 
                       +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+ rqv+vWFqnrRA
  TRIDC2AG059990.2  65 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRSRQVEVWFQNRRA 116
                       69*************************************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    
LSLSSSLAPR THHVAMLLHA PERRLLEMPL LPAKRVCEVS ADEERSGQRG GSDDEDGGCG  60
MDGSRKKLRL SKDQSAVLED SFREHPTLNP RQKAALAQQL GLRSRQVEVW FQNRRASLCD  120
FVSASSNLGR S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16470SRKKLRL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-31HD-ZIP family protein